PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.15G060400.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family NF-YB
Protein Properties Length: 182aa    MW: 19437.4 Da    PI: 5.7429
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.15G060400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB184.58.3e-5827122297
                NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyr 91 
                          reqdrflPianvsrimkk+lPanakiskdaketvqecvsefisf+t+easdkcqrekrktingddllwa++tlGfe+yveplkvyl+++r
  Manes.15G060400.1.p  27 REQDRFLPIANVSRIMKKALPANAKISKDAKETVQECVSEFISFITGEASDKCQREKRKTINGDDLLWAMTTLGFEEYVEPLKVYLQRFR 116
                          89**************************************************************************************** PP

                NF-YB  92 elegek 97 
                          e+egek
  Manes.15G060400.1.p 117 ETEGEK 122
                          ****97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.101.2E-5423131IPR009072Histone-fold
SuperFamilySSF471131.32E-4029132IPR009072Histone-fold
PfamPF008084.7E-283296IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006156.6E-216078No hitNo description
PROSITE patternPS0068506379IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006156.6E-217997No hitNo description
PRINTSPR006156.6E-2198116No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 182 aa     Download sequence    Send to blast
MADSDNDSGG PHNPSTTSNT NDLSSPREQD RFLPIANVSR IMKKALPANA KISKDAKETV  60
QECVSEFISF ITGEASDKCQ REKRKTINGD DLLWAMTTLG FEEYVEPLKV YLQRFRETEG  120
EKTAVARDKD APGNGGGFAV EGYAGGYHSH VYGSGGGFYN QMGGVGLGKG SGPSYSGSRP  180
N*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n1j_A9e-4825117193NF-YB
4awl_B9e-4825117294NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A9e-4825117294NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012071013.11e-103PREDICTED: nuclear transcription factor Y subunit B-3-like
SwissprotO233102e-71NFYB3_ARATH; Nuclear transcription factor Y subunit B-3
TrEMBLA0A067L4651e-103A0A067L465_JATCU; Uncharacterized protein
TrEMBLA0A0H3XRM81e-103A0A0H3XRM8_VERFO; Nuclear transcription factor Y subunit B-7
STRINGPOPTR_0001s37620.12e-89(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF59134150
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14540.11e-73nuclear factor Y, subunit B3